Oecophyllibacter saccharovorans: E3E11_00125 Help Entry E3E11_00125       CDS       T06092                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism neh  Oecophyllibacter saccharovorans Pathway neh01100   Metabolic pathways neh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:neh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E3E11_00125    00074 Mycolic acid biosynthesis     E3E11_00125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E3E11_00125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  QDH15873 LinkDB All DBs Position complement(31720..31962) Genome browser AA seq 80 aa AA seqDB search MSNEIADKVKKIVVEHLGVEDSKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDA AEKIATVSDAIDYISKQKAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgaaattgctgataaggtgaagaagatcgtcgtcgaacatctgggcgttgag gacagcaaggtcaccccggatgcttccttcattgatgatctgggcgccgatagccttgat acggttgaactcgtcatggcctttgaagaagctttctcggtggaaattcctgaagatgcc gccgagaaaattgcgactgtttccgacgcgatcgactacatcagcaagcagaaagcggcc tga

DBGET integrated database retrieval system