Neisseria chenwenguii: BG910_04035 Help Entry BG910_04035       CDS       T05718                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nei  Neisseria chenwenguii Pathway nei01100   Metabolic pathways nei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BG910_04035    00074 Mycolic acid biosynthesis     BG910_04035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BG910_04035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ASK27020 UniProt:  A0A220S0K9 LinkDB All DBs Position complement(835465..835701) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYIAAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacatcgaacaacaagttaagaaaattgttgctgaacaactgggcgtaaacgaa gccgaagtgaaaaacgaatcttctttccaagacgatttgggcgccgactctctggacacc gttgagctggttatggctttggaagaagccttcggttgcgaaattcccgacgaagaagcc gaaaaaatcaccaccgtacaactggctatcgactacatcgctgcccacaacggctaa

DBGET integrated database retrieval system