KEGG   Neisseria chenwenguii: BG910_10510
Entry
BG910_10510       CDS       T05718                                 
Name
(GenBank) aromatic acid/H+ symport family MFS transporter
  KO
K08195  MFS transporter, AAHS family, 4-hydroxybenzoate transporter
Organism
nei  Neisseria chenwenguii
Brite
KEGG Orthology (KO) [BR:nei00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nei02000]
    BG910_10510
Transporters [BR:nei02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Aromatic acid:H+ symporter (AAHS) family [TC:2.A.1.15]
    BG910_10510
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-ProteinID: ASK28100
UniProt: A0A220S3P7
LinkDB
Position
complement(2175240..2176580)
AA seq 446 aa
MPQTPNNEINVRALLDHRGVSRYQKTVIFLCFLIVLMDGFDVVIMGFVAPSLKAAWNLSN
SDLAPVLSAALFGLTFGALGTGPLGDRFGRRKVLIACVFTFGLFTLLVALAAEVRQMMAF
RFIAGLAMGGIMPMVATLAKEYSPVRRSALLVTVVFAGFTVGAAGGGFLAAWLIPHWGWH
SVFVFGGVMPVLLSVYMMFKLPESLAFMVHKGTDRAEIRKIVEACAPGSTNENSVFTLPA
AAVQTDANPMKTVFNSHYAKGTLLLWIIYFSHLFLVYLLGNWMPTMINESGMTAEQASVI
SAMFQLGGPLGSIMLGWFMDRFEAHRILALSYFSGAAVLVVMSGLGAQYLLLCLTSFFIG
AAFNGGGTGMNALSSNFFPLSARATGNSWMHGVGRTGAIVSAYAGSWMLNMGWNFSTIAF
ALTVPALIISASLMLKYSFYAGTEKS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgccgcaaacgccaaacaacgaaatcaacgtccgcgccctgctcgaccaccgcggcgtc
agccgctatcagaaaacagtcattttcctctgcttcctgatcgttctgatggacggcttc
gacgtcgtaatcatgggtttcgttgccccttcgctgaaggcggcctggaacctgagcaac
agcgaccttgcgcccgtattgagcgcggcgctgttcggcctgacgttcggcgcgctgggc
acggggccgctcggcgaccgtttcgggcggcgcaaagtgctgattgcctgcgtgttcacg
ttcgggctgtttaccctcttggtggccttggccgccgaagtccgccagatgatggcgttc
cgttttatcgcgggtttggcgatgggcggcatcatgccgatggtggcgactctggctaaa
gaatattcgccggtccggcgcagcgcgcttttggttaccgtcgtttttgccggatttacc
gtaggcgctgcgggcggcggttttttagcggcctggctgattccgcattggggctggcac
agcgtcttcgtcttcggcggcgtgatgccggttttattgagtgtgtacatgatgttcaag
ctgcctgaatcgctggcatttatggtgcacaaagggacagaccgcgccgaaatccgcaaa
atcgtcgaagcctgcgcaccgggcagcaccaacgaaaacagcgtctttaccctgcccgca
gcggctgtacagaccgatgccaatccgatgaagaccgtgttcaacagccattacgccaaa
ggcacgctgcttttgtggattatttatttttcccacctctttctcgtgtacctcttgggc
aactggatgccgaccatgattaacgaatcaggcatgacggcggaacaggcttcggtcatc
tcggcgatgttccaactcggcggcccgctgggatcaatcatgctcggctggtttatggac
cgtttcgaggcgcaccgcattctggcactctcctacttcagcggcgccgccgtattggtt
gtgatgagcggtttgggcgcgcaatacctgctgctctgtctgacctcgtttttcatcggc
gcggcgtttaacggcggcggcacgggcatgaacgcactctccagcaatttcttcccactc
tccgcacgcgccacgggcaacagctggatgcacggcgtcggccgcacaggtgccatcgtt
tccgcatacgcaggctcgtggatgctgaatatgggctggaacttctccaccatcgccttc
gcgctgaccgttcctgccctcatcatctccgcctcgctgatgctgaaatattccttctac
gccggaacggaaaaatcctga

DBGET integrated database retrieval system