Neisseria sp. KEM232: CGZ77_02340 Help Entry CGZ77_02340       CDS       T05913                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nek  Neisseria sp. KEM232 Pathway nek01100   Metabolic pathways nek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGZ77_02340    00074 Mycolic acid biosynthesis     CGZ77_02340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGZ77_02340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASP16676 LinkDB All DBs Position 494848..495138 Genome browser AA seq 96 aa AA seqDB search MSYTFTLAPQALETELKKLILQESGKADDIAPEDFSDDAPLFGDGSPVALDSLDALQISV ALQQHFQVRLQGDRMVRKHMMCIRGLAAFVRREHGA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcctacaccttcacccttgctccgcaagcactcgaaaccgaattgaaaaaactcatt ctgcaagagtccggcaaagccgacgacatcgcccctgaagacttctccgacgacgcgccg ctgttcggcgacggcagccctgtcgccctcgattcgcttgacgcgctgcaaatcagcgtt gccctgcaacagcatttccaagtgcggctgcaaggcgaccgcatggtacgcaaacacatg atgtgcatacgcggtttggccgcattcgtgcggcgggaacacggcgcatga

DBGET integrated database retrieval system