Neisseria elongata: NELON_01000 Help Entry NELON_01000       CDS       T03569                                  Name (GenBank) ribose 5-phosphate isomerase   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism nel  Neisseria elongata Pathway nel00030   Pentose phosphate pathway nel00051   Fructose and mannose metabolism nel00710   Carbon fixation by Calvin cycle nel01100   Metabolic pathways nel01110   Biosynthesis of secondary metabolites nel01120   Microbial metabolism in diverse environments nel01200   Carbon metabolism nel01230   Biosynthesis of amino acids Module nel_M00004   Pentose phosphate pathway (Pentose phosphate cycle) nel_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:nel00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     NELON_01000    00051 Fructose and mannose metabolism     NELON_01000   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     NELON_01000 Enzymes [BR:nel01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      NELON_01000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB PTS_IIB Motif Other DBs NCBI-ProteinID:  AJE17595 UniProt:  D4DUY2 LinkDB All DBs Position 183193..183633 Genome browser AA seq 146 aa AA seqDB search MRLVIAAPANGAILKDALKAHLQNDPRVGSLVDLSSPEGTYPQLSFAAAQEVAAGRADRA LLICGTGVGTAIAANKVRGIRAATAHDLLTVRGSVENYDAQVLCMGQNVIAAPAAWALVD IWLDLRHDTSSSYAPKVGEIEAYERG NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcgtttggttattgccgcgccggccaacggcgcgatattgaaagacgcgctcaaagcg catttgcaaaacgacccacgtgtcggcagtttggttgatttgtcttcacccgaaggaacg tatccgcagctttcgtttgcggcggcgcaggaagtggcggcagggcgtgccgaccgtgcg ctgctgatttgcggtacgggcgtgggtacggcgattgccgccaataaggtacgcggtata cgggcggcgacggcgcacgatttgcttaccgtccgcggttcggtggaaaactatgacgcg caggtgctgtgcatggggcagaacgtcattgccgcgcctgccgcatgggctttggtggat atttggctggatttgcgccacgacacaagcagcagttatgcgcctaaggttggcgaaatc gaggcgtatgaacgcggctga

DBGET integrated database retrieval system