Neisseria elongata: NELON_09375 Help Entry NELON_09375       CDS       T03569                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nel  Neisseria elongata Pathway nel01100   Metabolic pathways nel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NELON_09375    00074 Mycolic acid biosynthesis     NELON_09375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NELON_09375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJE19091 UniProt:  D4DPD0 LinkDB All DBs Position 1785085..1785345 Genome browser AA seq 86 aa AA seqDB search MTDLKQEIKQLIIDSLGLEDLTPADIGDEEALFGDSGLGLDSVDALELGLAVQKHFGFQL DGESQELRDSFANVSTLAAFVQKQRG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgactgacttgaaacaagaaatcaaacaactgattatcgacagcctcggcctggaagac ctcacgcccgccgacatcggcgacgaagaagccctgttcggcgacagcggcctcggcctc gattccgtagacgcactcgaactcggcttggccgtgcaaaaacacttcggcttccagctc gacggcgaaagccaggagctgcgcgacagcttcgccaatgtgtccacattggccgccttc gtgcagaaacaacgcggctaa

DBGET integrated database retrieval system