Neorhizobium sp. NCHU2750: NCHU2750_10110 Help Entry NCHU2750_10110    CDS       T05650                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nen  Neorhizobium sp. NCHU2750 Pathway nen01100   Metabolic pathways nen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCHU2750_10110 (acpP)    00074 Mycolic acid biosynthesis     NCHU2750_10110 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCHU2750_10110 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  AYD00404 LinkDB All DBs Position 1027163..1027399 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgtcattgaccatctcggcgttgatgcc gacaaggttgtcgaaggcgcaagcttcatcgacgatctcggtgcagattcgctcgacacc gtcgaactggtcatggctttcgaagaagagttcggcgttgaaatcccggacgacgctgct gactcgatcctgaccgtcggcgacgctgtcaagttcatcgaaaaggcccaggcctga

DBGET integrated database retrieval system