KEGG   Neorhizobium sp. NCHU2750: NCHU2750_55510
Entry
NCHU2750_55510    CDS       T05650                                 
Symbol
nos
Name
(GenBank) D-nopaline dehydrogenase
  KO
K00296  D-nopaline dehydrogenase [EC:1.5.1.19]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00330  Arginine and proline metabolism
nen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NCHU2750_55510 (nos)
Enzymes [BR:nen01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.19  D-nopaline dehydrogenase
     NCHU2750_55510 (nos)
SSDB
Motif
Pfam: Octopine_DH Band_7_1
Other DBs
NCBI-ProteinID: AYD04919
UniProt: A0A386ECV3
LinkDB
Position
pTiNCHU2750:complement(26924..27943)
AA seq 339 aa
MINGSFTVSASDDLLAVIRSSHLLIIVTRADVHDSFVSELANFNGELAEKDILVVCGHGF
SMKYERQLQCKRILETDNSPTTSKLSDKKKCKVNIKEMKASFGLSCFPIHRNDVGVIDLP
EDIKIIFAQLFTARIIPIPPLQVLFFSNYITHAIAAVMNIGRLRDPVNSLTKRAEQWLLE
LDERTPRAETDFFFYGEGSNTYVCNVQEQVDQERRKVAKACGLHLNSLLQECNDEYGTNY
ATLREYCLAPSPHNVHYACPDNMEHRYFSEELCSLEDIAAIATITKIEMPLTRAFINIIH
AGKANFPPTDKTSSVIGNFRSGDLIRFGATILVKDEMMK
NT seq 1020 nt   +upstreamnt  +downstreamnt
gtgatcaacggttcatttacggtctcagcctctgatgatctgctcgcagttattcgctcc
agccatctactgattattgtcacccgtgcggacgttcacgacagcttcgtcagtgaacta
gccaacttcaacggtgaactcgcagaaaaggatattctcgtcgtctgcggccatgggttt
tccatgaagtacgagaggcagctgcaatgcaagcgaatactcgagacggataattcgccc
acaacgtctaagctatcggataaaaaaaaatgtaaggtcaacatcaaggaaatgaaagct
tctttcggactgtcgtgtttcccaattcatcgaaatgatgttggcgtcatcgatttaccc
gaagatatcaagatcatcttcgcccagctatttacggctaggatcatccccatcccacca
ttgcaggtgctgttcttttccaactatatcactcatgcgattgccgctgttatgaacatc
ggaagattgcgcgaccctgtcaattcccttaccaaaagagctgagcagtggcttcttgaa
ctagacgagcgaaccccacgagccgagacggactttttcttttatggtgaaggatccaac
acttacgtttgcaatgttcaagagcaggtagaccaagagcgccggaaggttgccaaagcg
tgtgggttgcatctcaattctctcttgcaggaatgcaatgatgaatatggcactaattat
gcgaccctaagggaatattgcctcgcaccatcacctcataacgtgcattatgcatgccct
gacaacatggaacatcgttatttttctgaggaattatgctcattggaggatatcgcggca
attgcaactattaccaaaatcgagatgcccctcacccgcgcgttcatcaatattattcat
gcgggaaaggcaaactttccgccaactgacaaaacatccagcgtgattggtaacttcagg
tcaggagacttgatccgctttggtgccaccatacttgttaaggatgagatgatgaagtaa

DBGET integrated database retrieval system