Neorhizobium sp. SOG26: CYG48_00525
Help
Entry
CYG48_00525 CDS
T05626
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
neo
Neorhizobium sp. SOG26
Pathway
neo02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
neo00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
CYG48_00525 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
neo02022
]
CYG48_00525 (phoB)
Two-component system [BR:
neo02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
CYG48_00525 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
GerE
Motif
Other DBs
NCBI-ProteinID:
AXV14333
LinkDB
All DBs
Position
106757..107440
Genome browser
AA seq
227 aa
AA seq
DB search
MLPRIAVVEDEEALSVLLRYNLEAEGYDVETIMRGDEAEIRLQERTPDLLILDWMLPGVS
GIELCRRLRARPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRARPEVLSSVLRCGDIELDRETHRVHRKSREVRLGPTEFRLLEFLMASPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAGYSMEA
NT seq
684 nt
NT seq
+upstream
nt +downstream
nt
atgctgccacggattgctgtcgtagaggatgaggaggcgctgagcgtgcttctccgctac
aaccttgaagctgagggttacgatgtcgaaacgatcatgcggggcgatgaagccgagatc
cggctgcaggagcgcaccccggatctcttgatcctcgactggatgctgccgggcgtttcc
ggcatcgagctttgccgtcgcctgcgcgcccgacccgaaaccgagcgcctgccgatcatc
atgctgacggcgcgtggcgaggaaagcgagcgggtccggggtcttgccacgggggcagac
gattatgtggtcaagcccttctcgacgccggagctgatggcgcgcgtcaaggcgatgctg
cggcgggcgcgcccggaagtgctgtccagcgtccttcgctgcggtgatatcgagctcgat
cgcgagacccatcgcgtccaccgcaagagccgtgaggtgcggcttgggcccacagaattc
cgcctcctggagttcctgatggcctctcccggccgcgtgttctcacgttcgcagctgctg
gatggcgtctggggccacgacatctatgtcgatgagcgcaccgtcgacgtccatgtcggg
cgcctccgcaaggcgctcaacttctccaacatgcaggatgtgatccgcaccgttcggggt
gcgggctattcgatggaggcctga
DBGET
integrated database retrieval system