Neorhizobium sp. SOG26: CYG48_03755 Help Entry CYG48_03755       CDS       T05626                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism neo  Neorhizobium sp. SOG26 Pathway neo01100   Metabolic pathways neo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:neo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CYG48_03755    00074 Mycolic acid biosynthesis     CYG48_03755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CYG48_03755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  AXV14886 LinkDB All DBs Position 758467..758703 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgaacgcgttaagaaaattgttattgatcatctcggcgtcgatgcc gacaaggtagttgaaggcgcaagcttcatcgacgatcttggcgcggactcgctcgacacc gtcgaactggtcatggctttcgaagaagaattcggcgttgaaattcctgacgatgccgcc gattccattctgaccgtcggcgacgcagtgaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system