KEGG   Neorhizobium sp. SOG26: CYG48_05355
Entry
CYG48_05355       CDS       T05626                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:neo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CYG48_05355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:neo03011]
    CYG48_05355
Ribosome [BR:neo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CYG48_05355
  Bacteria
    CYG48_05355
  Archaea
    CYG48_05355
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e HSP33
Other DBs
NCBI-ProteinID: AXV15179
LinkDB
Position
1065338..1065700
AA seq 120 aa
MATRKEALTKRASRVRRQLKKVANGRPRLSVHRSSKNIYAQVIDDVAGRTLAAASTLDAG
LKGSLKTGADVAAAAAVGKLVAERATQAGVKEVVFDRGAFIYHGRIKALADAAREGGLSF
NT seq 363 nt   +upstreamnt  +downstreamnt
atggctaccagaaaagaagcactcaccaagcgtgcgagccgtgtccgccgccagctcaag
aaggtcgcaaacggccgtccgcgtctgtcggttcaccgctcctccaagaacatctatgcc
caggttatcgacgacgttgccggccgcacgcttgctgccgcttcgacgctcgatgcaggt
ctcaagggctcgctcaagacgggcgccgacgttgcagcagctgctgccgttggcaagctc
gtcgccgagcgtgcgacgcaggctggcgtgaaggaagtcgtgttcgatcgcggcgctttc
atctatcacggccgcatcaaggctcttgctgacgctgcccgcgaaggcggcctgagcttc
taa

DBGET integrated database retrieval system