Nitrosomonas europaea: NE0639 Help Entry NE0639            CDS       T00130                                  Name (GenBank) mttA/Hcf106 family   KO K03116   sec-independent protein translocase protein TatA Organism neu  Nitrosomonas europaea Pathway neu03060   Protein export neu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:neu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     NE0639  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     NE0639  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:neu02044]     NE0639 Secretion system [BR:neu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    NE0639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  CAD84550 UniProt:  Q82WM9 LinkDB All DBs Position complement(698288..698518) Genome browser AA seq 76 aa AA seqDB search MGSFSIWHWLVVLAIVVLVFGTKKLRNLGSDLGGAVRGFKEGMKGAEEESTPPPPAQQVT GHSIKSEIEEKDQTKV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggaagtttcagtatttggcactggctggttgttctggcaattgtcgtcctggtattc gggaccaaaaaactgcgcaatcttggcagtgatctgggcggagcagtccgtggattcaaa gagggaatgaaaggggctgaagaagaaagcactccgccccccccggctcagcaggtcacc ggccattcgatcaaaagtgaaatagaagaaaaagatcagacgaaagtgtga

DBGET integrated database retrieval system