Nitrosomonas europaea: NE2163 Help Entry NE2163            CDS       T00130                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism neu  Nitrosomonas europaea Pathway neu01100   Metabolic pathways neu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:neu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NE2163    00074 Mycolic acid biosynthesis     NE2163   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NE2163 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CAD86074 UniProt:  Q82SY3 Structure PDBPDBj LinkDB All DBs Position complement(2346926..2347177) Genome browser AA seq 83 aa AA seqDB search MQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVDDD EISAQTFETLGSLALFVEHKLSH NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcagcatcttgaagcagtcagaaacattttgggtgatgtgttgaatctcggagagaga aaacacacgctgacagccagttccgttttactcggaaatattccggagctggattcgatg gcggtggtcaatgtgattaccgcgctcgaggaatacttcgatttctcggtggatgacgat gaaatcagtgcacagacttttgaaacactcggaagcctggcgctttttgtcgaacataaa ctgtcgcactga

DBGET integrated database retrieval system