Nocardiopsis exhalans: NE857_21215 Help Entry NE857_21215       CDS       T08285                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nex  Nocardiopsis exhalans Pathway nex00998   Biosynthesis of various antibiotics nex01100   Metabolic pathways nex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NE857_21215    00074 Mycolic acid biosynthesis     NE857_21215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NE857_21215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  USY17839 UniProt:  A0ABY5D0R4 LinkDB All DBs Position 4824315..4824554 Genome browser AA seq 79 aa AA seqDB search MALSEQEILAGLGEIVEEIVGTEPSEVTPEKSFVDDLDIDSLSMVEIAVAAQDKFGVEIP DDQLKDLKTVQDVINFIQK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggccctcagcgagcaggaaatcctggccggcctcggcgagatcgtcgaagagatcgtc ggcaccgagccttccgaggtcacgcccgagaagagcttcgtggacgacctggacatcgac tcgctgtccatggtggagatcgccgtcgccgcgcaggacaagttcggcgtggagatcccc gacgaccagctcaaggacctcaagacggtccaggacgtcatcaacttcatccagaagtag

DBGET integrated database retrieval system