Neodiprion fabricii: 124175740 Help Entry 124175740         CDS       T08986                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism nfb  Neodiprion fabricii Brite KEGG Orthology (KO) [BR:nfb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:nfb03041]     124175740   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nfb04052]     124175740 Spliceosome [BR:nfb03041]  Complex B   Other components    Complex B specific factors     124175740 Cytokines and neuropeptides [BR:nfb04052]  Neuropeptides   Unclassified    124175740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  124175740 NCBI-ProteinID:  XP_046412181 LinkDB All DBs Position 2:complement(23118862..23121149) Genome browser AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTHWEKIVLKKWYTIFKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcttgagatcacttgcaatgaccgtcttggaaaaaaagtaagagtgaaatgtaatccc gatgacacgataggagatctaaaaaagctgatagcggcgcaaacgggaacccattgggaa aagatagtcttaaaaaaatggtacaccatattcaaagaccacattaagctccaagactat gaaatacacgatggtatgaatttggagttgtattaccagtga

DBGET integrated database retrieval system