Neodiprion fabricii: 124187016 Help Entry 124187016         CDS       T08986                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism nfb  Neodiprion fabricii Pathway nfb04814   Motor proteins Brite KEGG Orthology (KO) [BR:nfb00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124187016  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nfb03037]     124187016    04812 Cytoskeleton proteins [BR:nfb04812]     124187016 Cilium and associated proteins [BR:nfb03037]  Motile cilia and associated proteins   Dynein arm    124187016 Cytoskeleton proteins [BR:nfb04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124187016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  124187016 NCBI-ProteinID:  XP_046435213 LinkDB All DBs Position 7:complement(23284442..23285967) Genome browser AA seq 111 aa AA seqDB search MEDMQEETQFVVDDVSKIIKDAIEVSIGGNAYQHTKVNQWTSHVVEACLGNLTKLQKPYK YIVTCTIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaagatatgcaggaggagacccaatttgtcgtcgacgatgtcagtaagataataaaa gatgcgattgaggtttccatcgggggcaacgcctaccaacacactaaggttaatcaatgg acatctcacgtagttgaagcctgcctgggaaacctcacgaagctacagaaaccttacaaa tatatcgtgacttgtaccatcatgcaaaagaacggtgcaggcttgcatacagcaagttcg tgcttttgggacaatgcaacggatggaagttgcacagttcgctgggagaacaaaacgatg tattgtatcgtgtccgtttttggtctggcgatttaa

DBGET integrated database retrieval system