Neodiprion fabricii: 124187742 Help Entry 124187742         CDS       T08986                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism nfb  Neodiprion fabricii Pathway nfb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nfb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124187742  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nfb04121]     124187742    03400 DNA repair and recombination proteins [BR:nfb03400]     124187742 Ubiquitin system [BR:nfb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124187742    Cul5 complex      124187742 DNA repair and recombination proteins [BR:nfb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124187742 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124187742 NCBI-ProteinID:  XP_046435774 LinkDB All DBs Position 1:4728133..4730701 Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVLELKKIIEGILKIAPANQQLYSKDNVIMSDNKFLSD YGMTSAVAKAQCPALVALALRQEGGQFEPLEMTPYSLPPDLPDVMKSQEANGKEQTP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacgtattcctcatgatcaggcgaaagaaaacgactatttttacagacgcgaaagac aacactaccgttcttgaattaaaaaagatcatagaaggtatactgaagattgctccggcg aatcaacaactctacagcaaagacaatgtcatcatgtccgataacaaatttttgtcggat tacggaatgacgtcggcagtggcaaaagcacaatgccctgctctggttgctttagcccta cgccaagaagggggtcagtttgaacctctggaaatgacaccttactcgttaccacctgat ctccctgatgtaatgaaatcccaggaagccaacggcaaagaacaaactccgtga

DBGET integrated database retrieval system