Nocardioides faecalis: KG111_12340 Help Entry KG111_12340       CDS       T09118                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism nfc  Nocardioides faecalis Brite KEGG Orthology (KO) [BR:nfc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     KG111_12340 Enzymes [BR:nfc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      KG111_12340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like GST_N_3 Thioredoxin DUF3088 Ank_KRIT1 Thioredoxin_9 Motif Other DBs NCBI-ProteinID:  QVI57841 LinkDB All DBs Position 2644439..2644693 Genome browser AA seq 84 aa AA seqDB search MTAGTFTMYTTPWCGYCHRLKSQLDREGITFDIVDIEQQPEAASIVESANNGNQTVPTLV FADGTAQTNPSIAQVKAKLAELAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccgccggcaccttcaccatgtacaccaccccctggtgcggctactgccaccggctc aagagccagctggaccgcgagggcatcaccttcgacatcgtcgacatcgagcagcagccc gaggccgcctcgatcgtcgagtcggccaacaacggcaaccagaccgtgcccaccctcgtc ttcgccgacggcaccgcgcagaccaacccctcgatcgcgcaggtcaaggcgaagctcgcc gagctcgccggctga

DBGET integrated database retrieval system