Aspergillus fischeri: NFIA_093120 Help Entry NFIA_093120       CDS       T01070                                  Name (RefSeq) gtpase_rho   KO K04513   Ras homolog gene family, member A Organism nfi  Aspergillus fischeri Pathway nfi04011   MAPK signaling pathway - yeast nfi04081   Hormone signaling nfi04144   Endocytosis nfi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nfi00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     NFIA_093120   09133 Signaling molecules and interaction    04081 Hormone signaling     NFIA_093120  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     NFIA_093120  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     NFIA_093120  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nfi04131]     NFIA_093120   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nfi04147]     NFIA_093120    04031 GTP-binding proteins [BR:nfi04031]     NFIA_093120 Membrane trafficking [BR:nfi04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     NFIA_093120 Exosome [BR:nfi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NFIA_093120   Exosomal proteins of other body fluids (saliva and urine)    NFIA_093120   Exosomal proteins of colorectal cancer cells    NFIA_093120   Exosomal proteins of bladder cancer cells    NFIA_093120 GTP-binding proteins [BR:nfi04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     NFIA_093120 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-GeneID:  4587805 NCBI-ProteinID:  XP_001261247 UniProt:  A1DIZ3 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MPEVYVPTVFENYVCQVQAYGESVEVALWDTAGQEDYDRLRSLAYPDSDGVFICFAVDSP DSLDNAQEKWIREVLHFCKEVPVFLLGCKNDLRDDPSTIGDLLKTSQYPVKSAVAEEVGR GLGAVEYFDCSAKTGAGVDVALEKAVRHVLHGELAQEKGRKGRSFF NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgccagaggtctatgttcccaccgtcttcgagaactacgtgtgccaagttcaggcctac ggagagtctgtcgaagtggctctgtgggatactgctgggcaggaggattacgatcgattg cgatccctcgcatatcctgactccgacggcgtcttcatatgttttgctgtagattctccg gacagtttggataacgctcaagagaaatggataagagaggtattgcacttctgcaaagag gttcctgttttcctcctagggtgcaagaacgatcttcgtgacgacccttcaactattgga gaccttttaaagacttcacaatacccggtgaaatctgctgtggctgaagaagtgggccga ggcttgggcgctgttgagtattttgattgttctgcaaagaccggagccggcgtcgatgta gccttagagaaagcggttaggcatgtgttgcacggagaactggcacaggagaaagggaga aaaggccgcagtttcttctag

DBGET integrated database retrieval system