Nocardia farcinica NCTC11134: ERS450000_01020 Help Entry ERS450000_01020   CDS       T04524                                  Symbol xylH Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism nfr  Nocardia farcinica NCTC11134 Pathway nfr00362   Benzoate degradation nfr00621   Dioxin degradation nfr00622   Xylene degradation nfr01100   Metabolic pathways nfr01120   Microbial metabolism in diverse environments nfr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:nfr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     ERS450000_01020 (xylH)    00622 Xylene degradation     ERS450000_01020 (xylH)    00621 Dioxin degradation     ERS450000_01020 (xylH) Enzymes [BR:nfr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      ERS450000_01020 (xylH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF6381 Motif Other DBs NCBI-ProteinID:  CRY74859 UniProt:  A0A0H5NHZ2 LinkDB All DBs Position 1:complement(1016539..1016736) Genome browser AA seq 65 aa AA seqDB search MPIIEVTIAAGRDPRQLRQLIHELTAAAQRALDAPLPTIRVILRETPPTHFAAGDVTLAE RQGRT NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgccgatcatcgaggtcaccatcgccgccgggcgcgacccccggcaactgcggcagctg atccacgaactcaccgccgccgcccagcgcgccctggacgccccgctgccgaccatccgg gtgatcctgcgcgagaccccgcccacccatttcgccgccggtgacgtgaccctcgccgag cggcaggggcgcacctga

DBGET integrated database retrieval system