KEGG   Nonomuraea fuscirosea: OIE67_20510
Entry
OIE67_20510       CDS       T09742                                 
Name
(GenBank) hypothetical protein
Organism
nfs  Nonomuraea fuscirosea
SSDB
Other DBs
NCBI-ProteinID: WSA56903
LinkDB
Position
complement(4481068..4482390)
AA seq 440 aa
MTEETSFVTPCKHCGAPIEQRRGRGRPKAYCPDKDCQAAAKRERELRRATPGLEGALARA
EQLYDRMEVGLAAALEPLARALAEELSPAGVEAKISAVQAEAHTRVAIARTEREQAFEQV
RLAREAAEHARRQTAEMRQRLEEAESERETALADAERAREQALAALREAASTERQALQTV
EQAKRRAELAERRAEDAARQVDMTEQAKDQTTQELAERAGLAVKQAEDARSEVVQAQQAA
ELAREERDRARQDTAAAVRERERAEREAAGAKAREEVAAQERERAVARAVAAERAAAEAD
RDRAMALRDATQAQAEAERLAAKAAAAETDGAAALSRERKLVSKERARADAVAKERDRFQ
SELRLERIRLEDLRAELDAARAEAAHLRERAVAAELREQAAVAAELREQAVGAELREQAL
ATQQREQAVEPREEALEPQE
NT seq 1323 nt   +upstreamnt  +downstreamnt
gtgaccgaagagaccagcttcgtgacgccgtgtaagcactgcggcgcgccgatcgagcag
cggcggggccggggccggccgaaggcgtactgtcccgacaaggactgccaggccgccgcc
aagcgcgagcgggagctgcggcgggccaccccgggactggagggagcgctggccagggcc
gagcagttgtacgaccggatggaggtcgggctggccgccgccctcgaaccgctcgcacgg
gcgctggccgaggagctcagccccgccggggtcgaggccaagatcagcgccgtccaggcc
gaggcgcacacccgggtggccatcgcccgcaccgagcgggagcaggcgttcgagcaggta
cggctggcgcgggaggccgccgagcacgccaggaggcagaccgccgagatgcggcagcgc
ctggaggaggccgagagcgagcgcgagaccgcgctggccgatgcggaaagggcacgggag
caggctctggccgccctgcgcgaggccgccagcaccgagcggcaggcgttgcagacggtc
gagcaggccaaacggcgggccgagctggccgagcgcagagccgaggatgccgcccgtcag
gtcgacatgaccgagcaggccaaggaccagacgacgcaggagctggccgagcgggccggg
ctggccgtcaagcaggcggaggacgcgcggtccgaggtcgtacaggctcagcaggcggcc
gagctggcgcgggaggaacgtgatcgcgcccggcaggacacggcggccgcggtccgagag
cgcgagcgggccgaacgcgaggcggccggcgcgaaggcccgggaggaggtggcggcgcag
gagcgcgagcgcgccgtggcgcgagccgtcgcggcggaacgggccgccgctgaagcggac
cgcgaccgcgcgatggcgctcagggacgcgacccaggcacaggccgaggccgaacggctg
gcagccaaggcggcggcagcggagaccgacggggcggcggccctgtcacgggaacgaaag
ctggtctccaaggaaagggccagagccgatgcggtggccaaggagcgcgatcgcttccag
agcgaactgcggctggaacgaatccgcctggaggatttgcgagcggagctggacgcggca
cgcgcggaggcggcgcacctgcgcgaacgagcggtggctgcggagctgcgcgaacaagcg
gcggtggctgcggagctgcgcgaacaagcggttggtgcggagcttcgggaacaggcgctg
gcgacgcaacagcgggaacaagctgtggagccgcgggaagaggctttggagccgcaagaa
tga

DBGET integrated database retrieval system