Nannochloropsis gaditana: NGA_0384502 Help Entry NGA_0384502       CDS       T02917                                  Name (RefSeq) hypothetical protein   KO K03359   anaphase-promoting complex subunit 12 Organism ngd  Nannochloropsis gaditana Pathway ngd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ngd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NGA_0384502  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ngd04121]     NGA_0384502    03036 Chromosome and associated proteins [BR:ngd03036]     NGA_0384502 Ubiquitin system [BR:ngd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      NGA_0384502 Chromosome and associated proteins [BR:ngd03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     NGA_0384502 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANAPC_CDC26 Motif Other DBs NCBI-GeneID:  17360166 NCBI-ProteinID:  XP_005853394 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MLRRPPTRIELKPEDVEELEAIQERRRVERQHQLLHKAGTAGASAPLSNMADNNGGEPPG VRDVKTERPRTPTVAERIGLRK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcttcgacgcccgccaacacgcattgaactcaaaccagaagacgtggaagagctcgaa gccattcaagaacggcgacgggtagagcgacagcaccagctcctccataaggcggggact gcaggtgcttcggcccctttaagtaatatggccgacaataatggcggggagcctcctgga gtacgagacgtaaaaacggagcgtcctcgcacgcccacagttgccgagcgcataggtctg cgtaaatga

DBGET integrated database retrieval system