Natronobacterium gregoryi: Natgr_2109 Help Entry Natgr_2109        CDS       T02383                                  Name (GenBank) ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nge  Natronobacterium gregoryi Pathway nge03010   Ribosome Brite KEGG Orthology (KO) [BR:nge00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Natgr_2109   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Natgr_2109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nge03011]     Natgr_2109    04121 Ubiquitin system [BR:nge04121]     Natgr_2109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nge04147]     Natgr_2109 Ribosome [BR:nge03011]  Ribosomal proteins   Eukaryotes    Small subunit     Natgr_2109   Archaea     Natgr_2109 Ubiquitin system [BR:nge04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Natgr_2109 Exosome [BR:nge04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Natgr_2109   Exosomal proteins of colorectal cancer cells    Natgr_2109 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 FYVE Ribosomal_L37e Zn_Ribbon_TF Rcat_RNF216 Zn_ribbon_3 DUF7479 CHP02642 Cas12f1-like_TNB Tad3 zf-C2H2_FBX41 DUF7575 Motif Other DBs NCBI-ProteinID:  AFZ73291 UniProt:  L0AHK9 LinkDB All DBs Position complement(2063445..2063579) Genome browser AA seq 44 aa AA seqDB search MARYDHYGEDGSTEGEQCPRCGDVFLADHGDRKHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgatacgaccactacggcgaggacgggagcaccgagggcgagcagtgtccccgc tgtggtgatgtcttcctcgccgaccacggcgaccgcaagcactgcgggaagtgcggctac accgagtgggagtag

DBGET integrated database retrieval system