Natronobacterium gregoryi: Natgr_3245
Help
Entry
Natgr_3245 CDS
T02383
Name
(GenBank) TATA-box binding protein (TBP), component of TFIID and TFIIIB
KO
K03120
transcription initiation factor TFIID TATA-box-binding protein
Organism
nge
Natronobacterium gregoryi
Pathway
nge03022
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:
nge00001
]
09120 Genetic Information Processing
09121 Transcription
03022 Basal transcription factors
Natgr_3245
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
nge03000
]
Natgr_3245
03021 Transcription machinery [BR:
nge03021
]
Natgr_3245
Transcription factors [BR:
nge03000
]
Eukaryotic type
beta-Scaffold factors with minor groove contacts
TATA-binding proteins
Natgr_3245
Transcription machinery [BR:
nge03021
]
Eukaryotic type
RNA polymerase II system
Basal transcription factors
TFIID
Natgr_3245
RNA polymerase III system
TFIIIB
Natgr_3245
RNA polymerase I system
SL1/TIF-1B
Natgr_3245
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TBP
Motif
Other DBs
NCBI-ProteinID:
AFZ74374
UniProt:
L0ALP2
LinkDB
All DBs
Position
3197176..3197733
Genome browser
AA seq
185 aa
AA seq
DB search
MTDPKETITIENVVASTGIGQELDLGPVAMDLEGVEYDPELFPGAVYRIDDPKAALLLFR
SGKIVCTGAKSTDDMRRAVEIVFEKLRDLSIPVEPDGVTVQNIVSSADLGHHLNLNAIAI
GLGLENIEYEPEQFPGLVYRIDDPDVVLLLFGSGKIVITGGEQPDDAEQAVGQVRNRLGE
LGLLT
NT seq
558 nt
NT seq
+upstream
nt +downstream
nt
atgacggaccccaaagaaacgatcaccatcgagaatgtcgttgcctcgactggaattggg
caggaacttgatctcggacccgtggcgatggatctcgagggggtagagtatgacccggag
ctgttccccggggccgtctatcggatagacgatcccaaggcagccctgctgttgtttcgc
tccgggaagatcgtttgtaccggtgcgaaaagcaccgacgatatgcgccgtgcggtcgag
attgtatttgagaagctacgcgacctgtcgattccggttgaaccggacggtgtgaccgtc
cagaatatcgtctcgtcggctgatctgggccatcatctcaacctcaacgccattgcaatc
ggcctcgggctcgagaacatcgaatacgaacccgaacagttccccggactcgtctaccgg
atcgacgatcccgatgtcgttctgctgttatttgggagtggaaaaatcgttatcacgggg
ggagagcaacctgacgacgctgaacaggccgttggtcaagtgcggaatcgactcggcgaa
cttggtctgctcacgtga
DBGET
integrated database retrieval system