KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103736468
Entry
103736468         CDS       T03372                                 
Symbol
Mrap
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04927  Cortisol synthesis and secretion
ngi04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103736468 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103736468 (Mrap)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 103736468
NCBI-ProteinID: XP_008834204
LinkDB
Position
Un
AA seq 186 aa
MSGYSQTGLLYSERNQLSNLLPGAHSSVPDVSGWQMLPSSATAMANRTNASAPYYSYEYY
LDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVMLLFLILLYMSWSGSLQVRISPHHQIC
AWSHSLNFPFCLRRGSQGTAEVSRSRAGTDQWVQQESPSVSSPVVSTAPLALHWEQVLDG
GPQGIS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtctggatactcacagacaggcttgctctactctgagagaaatcagttaagcaacctc
ctccctggggctcacagctcagttccagatgtgagtggctggcagatgctgccttccagt
gccacagccatggccaacaggaccaacgcctctgccccgtactacagctatgaatattac
ctggactacttagacctcatcccagtggacgagaagaagctgaaagccaacaagcattcc
attgtcattgccttttgggtgagcctggctgcttttgtgatgctcctcttcctcattctg
ctctacatgtcctggtcaggctcgcttcaggtgcgaatcagcccccatcaccaaatatgc
gcgtggagtcacagcctcaacttccctttctgcctccggaggggctcccaagggacagca
gaggtgtccagaagcagagctggtactgaccagtgggtacagcaggagagtccctctgtc
tcatctcctgtggtttccactgcacctctggctctccactgggaacaagttctggatggg
ggtccccagggcatcagctga

DBGET integrated database retrieval system