KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741442
Entry
103741442         CDS       T03372                                 
Symbol
Mapk1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04148  Efferocytosis
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04218  Cellular senescence
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04350  TGF-beta signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04380  Osteoclast differentiation
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04540  Gap junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04611  Platelet activation
ngi04613  Neutrophil extracellular trap formation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04668  TNF signaling pathway
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04722  Neurotrophin signaling pathway
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04730  Long-term depression
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04917  Prolactin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05034  Alcoholism
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05207  Chemical carcinogenesis - receptor activation
ngi05208  Chemical carcinogenesis - reactive oxygen species
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103741442 (Mapk1)
   04012 ErbB signaling pathway
    103741442 (Mapk1)
   04014 Ras signaling pathway
    103741442 (Mapk1)
   04015 Rap1 signaling pathway
    103741442 (Mapk1)
   04350 TGF-beta signaling pathway
    103741442 (Mapk1)
   04370 VEGF signaling pathway
    103741442 (Mapk1)
   04371 Apelin signaling pathway
    103741442 (Mapk1)
   04668 TNF signaling pathway
    103741442 (Mapk1)
   04066 HIF-1 signaling pathway
    103741442 (Mapk1)
   04068 FoxO signaling pathway
    103741442 (Mapk1)
   04072 Phospholipase D signaling pathway
    103741442 (Mapk1)
   04071 Sphingolipid signaling pathway
    103741442 (Mapk1)
   04024 cAMP signaling pathway
    103741442 (Mapk1)
   04022 cGMP-PKG signaling pathway
    103741442 (Mapk1)
   04151 PI3K-Akt signaling pathway
    103741442 (Mapk1)
   04150 mTOR signaling pathway
    103741442 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103741442 (Mapk1)
   04148 Efferocytosis
    103741442 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103741442 (Mapk1)
   04210 Apoptosis
    103741442 (Mapk1)
   04218 Cellular senescence
    103741442 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103741442 (Mapk1)
   04520 Adherens junction
    103741442 (Mapk1)
   04540 Gap junction
    103741442 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103741442 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103741442 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103741442 (Mapk1)
   04613 Neutrophil extracellular trap formation
    103741442 (Mapk1)
   04620 Toll-like receptor signaling pathway
    103741442 (Mapk1)
   04621 NOD-like receptor signaling pathway
    103741442 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    103741442 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    103741442 (Mapk1)
   04660 T cell receptor signaling pathway
    103741442 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    103741442 (Mapk1)
   04659 Th17 cell differentiation
    103741442 (Mapk1)
   04657 IL-17 signaling pathway
    103741442 (Mapk1)
   04662 B cell receptor signaling pathway
    103741442 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    103741442 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    103741442 (Mapk1)
   04062 Chemokine signaling pathway
    103741442 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103741442 (Mapk1)
   04929 GnRH secretion
    103741442 (Mapk1)
   04912 GnRH signaling pathway
    103741442 (Mapk1)
   04915 Estrogen signaling pathway
    103741442 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    103741442 (Mapk1)
   04917 Prolactin signaling pathway
    103741442 (Mapk1)
   04921 Oxytocin signaling pathway
    103741442 (Mapk1)
   04926 Relaxin signaling pathway
    103741442 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    103741442 (Mapk1)
   04919 Thyroid hormone signaling pathway
    103741442 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    103741442 (Mapk1)
   04916 Melanogenesis
    103741442 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103741442 (Mapk1)
   04270 Vascular smooth muscle contraction
    103741442 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103741442 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103741442 (Mapk1)
   04725 Cholinergic synapse
    103741442 (Mapk1)
   04726 Serotonergic synapse
    103741442 (Mapk1)
   04720 Long-term potentiation
    103741442 (Mapk1)
   04730 Long-term depression
    103741442 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    103741442 (Mapk1)
   04722 Neurotrophin signaling pathway
    103741442 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    103741442 (Mapk1)
   04380 Osteoclast differentiation
    103741442 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103741442 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741442 (Mapk1)
   05206 MicroRNAs in cancer
    103741442 (Mapk1)
   05205 Proteoglycans in cancer
    103741442 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    103741442 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    103741442 (Mapk1)
   05203 Viral carcinogenesis
    103741442 (Mapk1)
   05230 Central carbon metabolism in cancer
    103741442 (Mapk1)
   05231 Choline metabolism in cancer
    103741442 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103741442 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103741442 (Mapk1)
   05212 Pancreatic cancer
    103741442 (Mapk1)
   05225 Hepatocellular carcinoma
    103741442 (Mapk1)
   05226 Gastric cancer
    103741442 (Mapk1)
   05214 Glioma
    103741442 (Mapk1)
   05216 Thyroid cancer
    103741442 (Mapk1)
   05221 Acute myeloid leukemia
    103741442 (Mapk1)
   05220 Chronic myeloid leukemia
    103741442 (Mapk1)
   05218 Melanoma
    103741442 (Mapk1)
   05211 Renal cell carcinoma
    103741442 (Mapk1)
   05219 Bladder cancer
    103741442 (Mapk1)
   05215 Prostate cancer
    103741442 (Mapk1)
   05213 Endometrial cancer
    103741442 (Mapk1)
   05224 Breast cancer
    103741442 (Mapk1)
   05223 Non-small cell lung cancer
    103741442 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103741442 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    103741442 (Mapk1)
   05161 Hepatitis B
    103741442 (Mapk1)
   05160 Hepatitis C
    103741442 (Mapk1)
   05171 Coronavirus disease - COVID-19
    103741442 (Mapk1)
   05164 Influenza A
    103741442 (Mapk1)
   05163 Human cytomegalovirus infection
    103741442 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103741442 (Mapk1)
   05165 Human papillomavirus infection
    103741442 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103741442 (Mapk1)
   05135 Yersinia infection
    103741442 (Mapk1)
   05133 Pertussis
    103741442 (Mapk1)
   05152 Tuberculosis
    103741442 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103741442 (Mapk1)
   05140 Leishmaniasis
    103741442 (Mapk1)
   05142 Chagas disease
    103741442 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103741442 (Mapk1)
   05020 Prion disease
    103741442 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    103741442 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    103741442 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103741442 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103741442 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103741442 (Mapk1)
   04934 Cushing syndrome
    103741442 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103741442 (Mapk1)
   01524 Platinum drug resistance
    103741442 (Mapk1)
   01522 Endocrine resistance
    103741442 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103741442 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103741442 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103741442 (Mapk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103741442 (Mapk1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103741442 (Mapk1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103741442 (Mapk1)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103741442 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase STATB_N FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 103741442
NCBI-ProteinID: XP_008840426
LinkDB
Position
Un
AA seq 348 aa
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREI
KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRW
YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDL
NCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPY
LEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtccgcgggcaggtgttcgacgtggggccgcgctacaccaacctctcgtacatcggc
gagggcgcctacggcatggtgtgctctgcttatgataatctcaacaaagttcgagtagct
atcaagaaaatcagtccttttgaacaccagacctactgccagagaaccctgagagagata
aaaatcttgctgcgcttcagacatgagaacatcattggcatcaatgatattattcgagca
ccaaccattgagcaaatgaaagatgtatatatagtacaggacctcatggaaacagatctt
tacaagctcttgaagacacaacacctcagcaatgaccatatctgctattttctttatcag
atccttagagggttaaaatacattcattcagctaatgttctgcaccgtgacctcaagcct
tctaacctgctgctcaacaccacttgtgatctcaagatctgtgactttggcctcgcccgt
gttgctgatccagatcatgatcacacagggttcctgacagaatatgtagccacacgttgg
tacagagctccagaaattatgttgaattccaagggctacaccaaatccattgatatttgg
tctgtgggctgtatcctggcagagatgctatccaacaggcccatcttcccaggaaagcat
tatcttgaccagctgaaccacattctaggtattcttggatctccatcacaggaagacctg
aactgtataataaatttaaaagctagaaactatttgctttctctcccacacaaaaataag
gtgccatggaacaggctgttcccaaatgctgactccaaagctctggacttactggacaaa
atgttgacatttaaccctcacaagaggattgaagtagaacaggctctggctcacccatat
ctggagcagtattatgacccaagtgacgagcccattgctgaagcaccattcaagtttgac
atggaattggatgacttgcctaaagagaagctcaaagaactcatttttgaagagactgct
agattccagccaggatacagatcttaa

DBGET integrated database retrieval system