Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH17740
Help
Entry
RG1141_CH17740 CDS
T03208
Name
(GenBank) Pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
ngl
Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
ngl00770
Pantothenate and CoA biosynthesis
ngl01100
Metabolic pathways
ngl01240
Biosynthesis of cofactors
Module
ngl_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
ngl00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
RG1141_CH17740
Enzymes [BR:
ngl01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
RG1141_CH17740
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
CDN54116
UniProt:
A0A068T7S2
LinkDB
All DBs
Position
1724402..1724896
Genome browser
AA seq
164 aa
AA seq
DB search
MTTAFYPGSFDPMTHGHLDVLVQALNVADTVIVAIGIHPGKVPMFTFEERAELIRASLAE
ALPDRAGHVSVVSFDKLVVDAARANGAGLLIRGLRDGTDLDYEMQMAGMNRQMAPDIQTV
FLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLKALNNKLKR
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atgacaactgctttttatcccggttctttcgatccgatgacacacggccatctggacgtg
cttgtccaggcgctgaatgtcgcggacacggtgatcgtcgcgatcggcattcatccgggc
aaggtgccgatgttcaccttcgaggagcgggccgaactcatcagggcgtcgcttgcagag
gcgctgccggacagggcgggccatgtttcggtcgtttcattcgacaagctggtggttgac
gccgcccgcgccaacggcgccgggcttctgatccgaggcctgcgcgatggcaccgatctc
gattatgaaatgcagatggctggcatgaaccggcagatggcgccggatatccagactgtt
ttcctaccggccggcaccgcctcgcggcccattacggccacattggtccggcagatcgcg
gccatgggcggcgacgtcagcgccttcgtgcctgccgcggtcctcaaggccctgaacaac
aagctgaaacgctga
DBGET
integrated database retrieval system