Nonomuraea gerenzanensis: LCN96_42550 Help Entry LCN96_42550       CDS       T07782                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ngn  Nonomuraea gerenzanensis Pathway ngn01056   Biosynthesis of type II polyketide backbone ngn01100   Metabolic pathways ngn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ngn00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     LCN96_42550    00253 Tetracycline biosynthesis     LCN96_42550  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ngn01004]     LCN96_42550    01008 Polyketide biosynthesis proteins [BR:ngn01008]     LCN96_42550 Lipid biosynthesis proteins [BR:ngn01004]  Polyketide synthase   Component type    LCN96_42550 Polyketide biosynthesis proteins [BR:ngn01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      LCN96_42550     Nonaketide PKS      LCN96_42550     Decaketide PKS      LCN96_42550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UBU10949 LinkDB All DBs Position complement(9165164..9165406) Genome browser AA seq 80 aa AA seqDB search MSANTFTPADLKTLLQAVGLGPAQDDYTLTFEQLALDSLARVEIATRIEDRFGLALEIDA DHTPAQVAALVNQRLAGAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcagccaacaccttcaccccggcagacctgaagaccctgctccaggccgtgggcctg gggcccgcgcaggacgactacaccctgaccttcgagcagctcgcgctggactcgctggcc agggtcgagatcgccacgaggatcgaggaccgcttcggcctcgccctggagatcgacgcc gaccacaccccggcgcaggtggccgcgctcgtcaaccagcgcctggcgggagccgcgtca tga

DBGET integrated database retrieval system