KEGG   Nocardia gipuzkoensis: LTT66_22745
Entry
LTT66_22745       CDS       T07945                                 
Name
(GenBank) cytochrome P450
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
ngp  Nocardia gipuzkoensis
Pathway
ngp00997  Biosynthesis of various other secondary metabolites
ngp01100  Metabolic pathways
ngp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    LTT66_22745
Enzymes [BR:ngp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     LTT66_22745
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: UGT66116
LinkDB
Position
complement(5024348..5025790)
AA seq 480 aa
MSTHTAVGRPVQRAWPIVGHGLALRSRPLEFFAELHRTPEPLARIRLGSRDAYLVTAPEL
IVSLLRGKEAHSVEKGAFFEAMRALLGDGVSVSAEPKHLRHRRLMAPAFHHEKIAGYVRI
MQQEADAMVDSWSDGARLELDDRLRVLAMRIVAKALFASELGEAVVAESLRSFPVIVDEL
PKRTMMPWLARIPLRNRTFDAAVRRLSDAIDHIIAEYRASETDYGDLVSMLLTARFDDGT
ALTDRELHDEVMTLYAAGFATTANTMAFAFYELARRADVRERVEEEVAEVLRGGPVTADN
IQRLQYTERVMAETLRRYAPTWLGTRETIEKLDLGGVTLPAGTTLFYSPYTLHNNPKYFD
DPARFDPDRWTPEYRKTVTRSGVYQPFGLGNRNCIGEPFAWYEAVTILATVVARARLEVV
PGAAVHEVARATLEVNHLPVTVRLRTAVLHTPSGEHHQPLFAKAPDVAGRPGLRDPSPKA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagtacgcatacggctgtcggccgccctgtccagcgagcatggccgattgtcggtcac
ggcctggcgctccgaagcaggccattggagttcttcgccgagctgcaccggacgccggag
ccgttggcgcgaatccgattgggcagcagagacgcctatctggtgaccgcgccggagctg
atcgtttcgttgctgcgcggcaaggaggcgcacagcgtcgagaagggggcattcttcgag
gccatgcgggcgctgctgggcgatggtgtgtccgtgtcggccgagccgaagcacctgcgg
catcgccgcctgatggcaccggcctttcaccacgagaagatcgccggctatgtgcggatc
atgcagcaggaagccgatgccatggtcgacagctggagtgacggcgcgcgattggagctc
gatgaccggttgcgggtgctggccatgcggatcgtcgcgaaggctttgttcgccagcgaa
ctcggcgaagcggtggtcgcggagtcgctgcgttcatttccggtgatcgtcgacgagcta
ccgaaacgcaccatgatgccgtggctggcgcgcatcccactgcgcaaccgcactttcgac
gccgcagtgcgcaggctctccgatgcgatcgaccacatcatcgccgaataccgcgcgagc
gaaaccgattacggcgacttggtgtcgatgctgctcaccgcccgcttcgacgacggcacc
gccctcaccgatcgcgagctccacgacgaggtgatgacgctctacgccgcgggtttcgca
accaccgccaacaccatggctttcgccttctacgagttggcgcggcgcgcggacgtgcga
gagcgggtcgaagaggaagtcgccgaggtgctgcgcggcggcccggtaaccgctgacaac
atccagcgtctccagtacaccgagcgagtgatggccgagacgctgcgccgatacgctccc
acctggctcggcacacgcgagacgatcgagaaactcgacctcggcggagtcacgctcccc
gcgggcaccacgctcttctactcgccgtacacgctgcacaacaacccgaagtacttcgat
gatccggcacgattcgacccggaccggtggacgccggaataccgcaagaccgtgacccga
tccggggtctaccagcccttcggcctcggcaaccgaaactgcatcggcgaaccgttcgcg
tggtacgaagcggtcaccatcctggctacggtggttgcgcgggcgcggctggaggtggtt
ccgggagctgccgtgcacgaggtcgcgcgggccacgctggaggtgaaccacctcccggtg
acggtgcgactgcgtaccgcagttctgcacacaccgtcgggtgaacaccatcagccgctc
tttgcgaaggcccccgacgttgctggcaggccgggactacgagacccttccccgaaagcg
tga

DBGET integrated database retrieval system