Naegleria gruberi: NAEGRDRAFT_34389 Help Entry NAEGRDRAFT_34389  CDS       T01241                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ngr  Naegleria gruberi Pathway ngr03010   Ribosome ngr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ngr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NAEGRDRAFT_34389   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NAEGRDRAFT_34389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ngr03011]     NAEGRDRAFT_34389    04121 Ubiquitin system [BR:ngr04121]     NAEGRDRAFT_34389 Ribosome [BR:ngr03011]  Ribosomal proteins   Eukaryotes    Large subunit     NAEGRDRAFT_34389   Archaea     NAEGRDRAFT_34389 Ubiquitin system [BR:ngr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NAEGRDRAFT_34389 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD HemeBinding_Shp TBK1_ULD Motif Other DBs NCBI-GeneID:  8861946 NCBI-ProteinID:  XP_002676015 JGI:  Naegr1_34389 UniProt:  D2VII4 LinkDB All DBs AA seq 78 aa AA seqDB search MPHQLFIKTLTGKLITIAVDMNDTVENVKLQIQDREGIYWDQQRLIYAGKDMEHGTTMGQ YCFYKEICIHLVLRLRGG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcctcaccaattgttcattaaaactctgactggcaaactcatcaccattgctgtggat atgaacgatacagtggaaaatgtcaagttacaaattcaagatcgggaaggaatttattgg gatcagcaaaggttgatttatgctggaaaggatatggaacatggtacaacaatgggacaa tactgtttttataaagaaatttgtattcatttggtgttgagattgagaggaggataa

DBGET integrated database retrieval system