Naegleria gruberi: NAEGRDRAFT_44880 Help Entry NAEGRDRAFT_44880  CDS       T01241                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ngr  Naegleria gruberi Pathway ngr03010   Ribosome ngr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ngr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NAEGRDRAFT_44880   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NAEGRDRAFT_44880  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ngr03011]     NAEGRDRAFT_44880    04121 Ubiquitin system [BR:ngr04121]     NAEGRDRAFT_44880 Ribosome [BR:ngr03011]  Ribosomal proteins   Eukaryotes    Large subunit     NAEGRDRAFT_44880   Archaea     NAEGRDRAFT_44880 Ubiquitin system [BR:ngr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NAEGRDRAFT_44880 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 TBK1_ULD Rad60-SLD_2 TUG-UBL1 Ubiquitin_5 UBL_UBAC1 Motif Other DBs NCBI-GeneID:  8862496 NCBI-ProteinID:  XP_002669132 JGI:  Naegr1_44880 UniProt:  D2W3I3 LinkDB All DBs AA seq 76 aa AA seqDB search MQLFVKTLTGRTITLEVESNDSIENVKRKVQDKEGISPDQQRLIFGGKQLEDGRTIGDYN LQKDSTLHLVLRLRGG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcaattatttgtcaaaacactcactggaagaactatcactttggaagttgaatctaat gattcaattgaaaatgtgaaaagaaaagtacaagataaggaaggaatttcaccagatcaa caaagactcatctttggtggaaaacaattggaagatggaagaactattggtgattacaat cttcaaaaggattcaactcttcatttagtattgagattgagaggtggttga

DBGET integrated database retrieval system