Nguyenibacter sp. L1: QN315_02370 Help Entry QN315_02370       CDS       T09784                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ngu  Nguyenibacter sp. L1 Pathway ngu02024   Quorum sensing ngu03018   RNA degradation Brite KEGG Orthology (KO) [BR:ngu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     QN315_02370 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     QN315_02370 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ngu03019]     QN315_02370 (hfq)    03036 Chromosome and associated proteins [BR:ngu03036]     QN315_02370 (hfq) Messenger RNA biogenesis [BR:ngu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      QN315_02370 (hfq) Chromosome and associated proteins [BR:ngu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     QN315_02370 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  WRH88500 LinkDB All DBs Position complement(523287..523583) Genome browser AA seq 98 aa AA seqDB search MAKEATQNVQDVFLNHVRRSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKH AISTVMPATPVVLFEPSRSEGAATELADKDLAGDADLL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaagaagcaacacagaacgttcaggacgtttttctcaaccatgtccgacgctcc aagacgccggtgacggtgttcctggtcaacggcgtgaagctgcagggcatcattacctgg ttcgacaatttctcggtgctgctgcggcgcgacgggcatacgcaactggtctacaagcat gcgatcagcacggtgatgccggcgaccccggtcgtgctgttcgagccctcgcgcagcgag ggggcggcgacggagctggcggacaaagatctggcgggggatgccgatctcctctga

DBGET integrated database retrieval system