Nguyenibacter sp. L1: QN315_06285 Help Entry QN315_06285       CDS       T09784                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ngu  Nguyenibacter sp. L1 Brite KEGG Orthology (KO) [BR:ngu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ngu03032]     QN315_06285    03036 Chromosome and associated proteins [BR:ngu03036]     QN315_06285    03400 DNA repair and recombination proteins [BR:ngu03400]     QN315_06285 DNA replication proteins [BR:ngu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QN315_06285 Chromosome and associated proteins [BR:ngu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QN315_06285 DNA repair and recombination proteins [BR:ngu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QN315_06285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 VWA_3 Motif Other DBs NCBI-ProteinID:  WRH89214 LinkDB All DBs Position complement(1392242..1392511) Genome browser AA seq 89 aa AA seqDB search MSKAFIAAVIQDSIDCTGVAANQAATDLMAAIIRELKKEGGFTLPSFGTFTVKKTKARKA LNPRTGEPVKVKAGKTVRFKASPNLKKAV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaagccttcatcgccgcagtaatccaggattcgatcgactgcacaggtgtcgct gccaaccaggcggccacggacctgatggccgctatcatccgggaactgaagaaggaaggt gggtttaccctgccgtcattcggcacctttacggtcaagaagaccaaggcgcgcaaggcg ctgaatccccgtacgggtgagccggtaaaggtgaaggccggcaagacggtgcgcttcaag gccagcccgaacctgaaaaaggcggtctga

DBGET integrated database retrieval system