Fusarium vanettenii: NECHADRAFT_84698 Help Entry NECHADRAFT_84698  CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism nhe  Fusarium vanettenii Pathway nhe03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:nhe00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     NECHADRAFT_84698  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nhe03036]     NECHADRAFT_84698    03400 DNA repair and recombination proteins [BR:nhe03400]     NECHADRAFT_84698 Chromosome and associated proteins [BR:nhe03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      NECHADRAFT_84698 DNA repair and recombination proteins [BR:nhe03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      NECHADRAFT_84698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-18kDa DUF2972 Motif Other DBs NCBI-GeneID:  9675177 NCBI-ProteinID:  XP_003050019 JGI:  84698 UniProt:  C7YTU2 LinkDB All DBs Position 9 AA seq 123 aa AA seqDB search MADTTGDEDREVLSHRLKAALWYAVGQIVDEQSLIRNRNATPQFIGALTELVWAQIGRAL ENVATDLETFSNHAGRTTVTTDDVLLLARKNPDLHQIMKDFIDQAKADKEAAKGRGSTSK GRR NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggctgacacaacaggcgatgaggatcgcgaggtattatcgcaccgcctcaaggccgcg ctgtggtacgccgtcggtcagattgtcgatgagcagtcactcatccgcaaccgcaatgcc acgccgcaatttattggcgccctcacagagctcgtctgggcccagataggccgggcgtta gaaaatgtggccaccgacttggagacgtttagcaaccacgcaggtcgtacaaccgtgacg acagatgatgtcctcctgctcgctagaaagaatcccgatcttcaccagattatgaaggat tttattgatcaggccaaggcggataaggaggcagccaaggggagagggagcacaagcaaa ggaagaagatag

DBGET integrated database retrieval system