Fusarium vanettenii: NECHADRAFT_9036 Help Entry NECHADRAFT_9036   CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K04393   cell division control protein 42 Organism nhe  Fusarium vanettenii Pathway nhe04011   MAPK signaling pathway - yeast nhe04144   Endocytosis nhe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     NECHADRAFT_9036  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     NECHADRAFT_9036  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     NECHADRAFT_9036  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nhe04131]     NECHADRAFT_9036    03036 Chromosome and associated proteins [BR:nhe03036]     NECHADRAFT_9036   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nhe04147]     NECHADRAFT_9036    04031 GTP-binding proteins [BR:nhe04031]     NECHADRAFT_9036 Membrane trafficking [BR:nhe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     NECHADRAFT_9036  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     NECHADRAFT_9036   Macropinocytosis    Ras GTPases     NECHADRAFT_9036 Chromosome and associated proteins [BR:nhe03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     NECHADRAFT_9036 Exosome [BR:nhe04147]  Exosomal proteins   Exosomal proteins of microglial cells    NECHADRAFT_9036   Exosomal proteins of breast milk    NECHADRAFT_9036 GTP-binding proteins [BR:nhe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     NECHADRAFT_9036 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  9669504 NCBI-ProteinID:  XP_003042421 JGI:  9036 UniProt:  C7ZH89 LinkDB All DBs Position 11 AA seq 148 aa AA seqDB search TYRIVVIGDDNAMKNKILQTYAYPRGATSREYTPKTFENFVVEVKVNNHLTRLALYDTTG QERYMRLRVLGYQSTSIFLVLSRKTKSGPELYQVENKWIPEIMEHCPGTPYLIVGTYRNK PGVEALPDNSVEGGRVAERAGAIGYTEC NT seq 444 nt NT seq  +upstreamnt  +downstreamnt acgtacagaatcgtcgtcatcggggatgacaatgcaatgaagaacaaaatccttcagact tacgcgtacccgagaggcgccacatcacgcgagtatacgccaaaaacctttgagaatttt gttgtggaagtcaaggttaataaccacttgacacgactagcgctgtatgatacgaccggc caagagaggtacatgcggcttcgagttctgggctaccaatcaactagcatatttcttgtg ctttcacggaagacaaagtcaggccctgaattgtaccaggttgagaacaaatggatccct gagatcatggagcactgccccgggaccccttatctcatagtggggacatacaggaataaa cctggggtggaagcactgcctgataactcagttgaaggcggccgggtcgcggaaagggct ggcgcaattggctacactgaatgt

DBGET integrated database retrieval system