Fusarium vanettenii: NECHADRAFT_9901 Help Entry NECHADRAFT_9901   CDS       T01612                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nhe  Fusarium vanettenii Pathway nhe03010   Ribosome nhe04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nhe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NECHADRAFT_9901   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NECHADRAFT_9901  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nhe03011]     NECHADRAFT_9901    04121 Ubiquitin system [BR:nhe04121]     NECHADRAFT_9901 Ribosome [BR:nhe03011]  Ribosomal proteins   Eukaryotes    Large subunit     NECHADRAFT_9901   Archaea     NECHADRAFT_9901 Ubiquitin system [BR:nhe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NECHADRAFT_9901 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD DUF2604 UBL_UBAC1 Plexin_RBD Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  9677828 NCBI-ProteinID:  XP_003040088 JGI:  9901 UniProt:  C7ZPM0 LinkDB All DBs Position 10 AA seq 80 aa AA seqDB search FVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK ESTLHLVLRLRGGIIEPSLK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttcgtgaagaccctgacgggcaagaccatcaccctcgaggtcgagtcctcggacaccatt gacaatgtcaagtccaagatccaggacaaggagggcattcccccggatcagcagcgactg atcttcgctggcaagcagcttgaggatggccgaactctctccgactacaacatccagaag gagtccaccctgcacctggtcctccgtctccgtggtggtatcattgagccctcgctcaag

DBGET integrated database retrieval system