Nitrosococcus halophilus: Nhal_0483 Help Entry Nhal_0483         CDS       T01198                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism nhl  Nitrosococcus halophilus Brite KEGG Orthology (KO) [BR:nhl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nhl03036]     Nhal_0483 Chromosome and associated proteins [BR:nhl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Nhal_0483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Gram_pos_anchor TarH Motif Other DBs NCBI-ProteinID:  ADE13669 UniProt:  D5BW19 LinkDB All DBs Position 493980..494252 Genome browser AA seq 90 aa AA seqDB search MTSLQWLLLGGLMVLVLGSGVSVVYVKHENRKLFMELQGLYKARDRLDDEWGRLLLEQST LVGQGRVERLARERLEMVVPGPTEVVIIKL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacatcgctgcagtggctgctattggggggattgatggtattggtcttaggttcggga gtatctgttgtttatgtcaaacatgagaaccgcaaattgtttatggaattacaaggcctt tataaggcaagggaccgattggatgatgagtggggacgcttgctgctggaacaaagcacc ttagttgggcaaggacgggtagaacgcttggctcgggaacggcttgagatggtggtgccg ggcccgactgaagtcgtgattatcaaactataa

DBGET integrated database retrieval system