Nitrosococcus halophilus: Nhal_3216 Help Entry Nhal_3216         CDS       T01198                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism nhl  Nitrosococcus halophilus Pathway nhl00998   Biosynthesis of various antibiotics nhl01100   Metabolic pathways nhl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nhl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Nhal_3216    00074 Mycolic acid biosynthesis     Nhal_3216   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Nhal_3216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADE16266 UniProt:  D5C019 LinkDB All DBs Position complement(3300417..3300689) Genome browser AA seq 90 aa AA seqDB search MNENTVGTHTIDEIILIISEVLQLSDRVRQRMTAETQLLGAVPEFDSMAVVSVITALEEH YGFVIDDDEVEASTFETVGSLVDFVNGKLL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaatgaaaatactgtcgggactcatactatcgatgagatcattctcattattagtgag gtgctgcagcttagtgaccgagtccgtcagcgcatgacggctgagacacagttgctaggt gccgtgccagagttcgactccatggcggtggtatctgtcattaccgccctagaagagcac tacgggtttgtgattgatgacgatgaagtagaggcatccacttttgagacggtgggaagc ctggtggattttgtgaacggaaaacttttgtga

DBGET integrated database retrieval system