KEGG   Natronomonas halophila: HWV23_05345
Entry
HWV23_05345       CDS       T07279                                 
Name
(GenBank) hypothetical protein
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
nho  Natronomonas halophila
Pathway
nho00190  Oxidative phosphorylation
nho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nho00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HWV23_05345
Enzymes [BR:nho01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     HWV23_05345
SSDB
Motif
Pfam: DUF6360 DUF726
Other DBs
NCBI-ProteinID: QLD85169
LinkDB
Position
complement(965509..965802)
AA seq 97 aa
MTTRPRLHTETSKVAGILAVALFGFLAAVFLTAGFGSPAGFGDGSVTRSLAYTMFDLPGG
DIAGEGFLVSFITIAVVLDAALDGAVMLAERDEEGGS
NT seq 294 nt   +upstreamnt  +downstreamnt
atgacgacgcgtccccgcctccatacggaaacgagcaaggtggccggaatcctggcggtg
gcgttgttcggcttcctcgccgccgtcttcctcaccgccggcttcgggtcgccggccggc
ttcggggatgggtcggtgacgaggtccctcgcctacacgatgttcgaccttcccgggggc
gacatcgccggtgaaggcttcctcgtgtccttcatcaccattgccgtcgtcctcgacgcc
gcgctggacggcgccgtcatgctcgccgagcgggacgaggagggtggttcctga

DBGET integrated database retrieval system