Novosphingobium humi: PQ457_02415
Help
Entry
PQ457_02415 CDS
T08806
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
nhum
Novosphingobium humi
Pathway
nhum02024
Quorum sensing
nhum03060
Protein export
nhum03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
nhum00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
PQ457_02415 (yidC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
PQ457_02415 (yidC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
PQ457_02415 (yidC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
nhum03029
]
PQ457_02415 (yidC)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
nhum02044
]
PQ457_02415 (yidC)
Mitochondrial biogenesis [BR:
nhum03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
PQ457_02415 (yidC)
Secretion system [BR:
nhum02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
PQ457_02415 (yidC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
Motif
Other DBs
NCBI-ProteinID:
WCT77851
UniProt:
A0ABY7TX58
LinkDB
All DBs
Position
515188..516945
Genome browser
AA seq
585 aa
AA seq
DB search
MSNQRNLIIAMLLTGLLLFGWDAGLRYFYPDMGKKPAAVASAAPTPAASTKPTREGGLGS
VVDQAIEAKALNADLNAGGRVKVEAPGLSGSINLVGAVVDDLSINRHKQTIDKDSPPVRL
FSPAGTPAEHFAQLGWVGQGVATPNGTTVWAAPAGAKLTPQTPVTLSWANTTGQTFTITF
SIDNDYMITAKQAVQNAGPAPISVQPFGLIRRTEKTASVDSWNIHSGPFGAYDEAVNFGV
NYKDVAEKGQVNPDGKTNWIGFTDIYWMSVLVPDAVPATGDYRSLGNQLFRADLIYQPQV
VAPGQTALRSTRLFAGAKESLLLDKYEAQGVTRFSLAIDWGWFRWFEKPIFWLLRSLFKF
VGNFGVAIILLTVIVRGIMFPVAQRQFSSMAAMKAIQPKMKALQERYKDDKAKLQEETLK
LYKEEGVNPLAGCLPIFLQIPVFFALYKVLMVSIDMRHQPFALWIHDLSAPDPKHILNLF
GLLPFDPPSFLAIGVLAVILGITMWLQFKLQPAAPDPAQQQVMGIMPWMMMFIMAPFASG
LLVYWITSNLLTIAQQKYLYARHPDLKKNVDKERAIVEAAAHKKK
NT seq
1758 nt
NT seq
+upstream
nt +downstream
nt
gtgagtaaccagcgcaatctgattattgccatgctgctgaccgggctgctgctgttcggc
tgggacgcgggcctgcgctatttctatcccgacatgggcaagaagcccgcagcggtggcc
tcggccgcgccgaccccggcggcaagcaccaagccgacccgcgagggcggccttggcagc
gtggtggatcaggcgattgaggccaaggcgctcaacgcggatcttaacgccggtggccgc
gtcaaggtggaagcgccgggcctgtcgggctcgatcaatctggtgggcgcggtggtcgat
gacctctcgatcaaccgccacaagcagaccatcgacaaggacagcccgccggtgcgcctg
ttcagccccgccggcacgcctgccgaacatttcgcgcagctgggctgggtgggccagggc
gtggcgacgcccaacggcaccactgtctgggccgcgcctgccggtgccaagctgacgccg
cagacgccggtgacgctgagctgggccaatacgacgggccagaccttcaccatcaccttt
tccatcgacaatgactacatgatcaccgccaagcaggccgtgcagaatgccggtcctgcg
ccgatcagcgtgcagcccttcggccttatccgccgcaccgaaaagaccgccagcgtcgat
tcgtggaacatccattcggggcctttcggcgcctatgatgaggcggtgaactttggcgtc
aattacaaggatgtcgccgaaaaggggcaggtcaatcctgatggcaagaccaactggatc
ggctttaccgacatctattggatgagcgtgctggtgcctgatgcggtgcccgccacgggc
gattaccgcagccttggcaaccagcttttccgcgccgacctcatctatcagccgcaggtg
gtggcccccggccagaccgcgctgcgctccacccgtctctttgcgggcgccaaggaaagc
ctgctgctcgacaagtatgaagcgcagggcgtgacccgcttcagcctcgccatcgactgg
ggctggttccgctggtttgaaaagccgatcttctggctgctgcgttcgctcttcaaattc
gtcggcaatttcggcgtcgccatcatcctgctgaccgtcatcgtgcgcggcatcatgttc
cccgtggcccagcgccagttctcgagcatggccgcgatgaaggcgatccagcccaagatg
aaggcgctgcaggaacgctataaggacgacaaggccaagctgcaggaagagacgctcaag
ctctataaggaagagggtgtgaacccgctggcgggctgtctgccgatcttccttcagatc
ccggtgttctttgcgctgtataaggtgctgatggtgtcgatcgacatgcgtcaccagcct
ttcgcgctgtggatccatgacctttcggcgccggaccctaagcatatcctcaacctgttc
ggcctgctgcccttcgatccgcccagcttcctggcgatcggcgtgctggccgtcattctg
ggcatcaccatgtggcttcagttcaagctgcaaccggccgcccccgatcctgctcagcag
caggtgatgggcatcatgccgtggatgatgatgttcatcatggcgccctttgcctcgggc
ctgctggtttactggatcacctcgaaccttctgaccattgctcagcagaagtatctgtat
gcacggcatcctgacttgaagaagaatgtcgataaggagcgcgccatcgtcgaagcggcg
gcgcataagaaaaagtga
DBGET
integrated database retrieval system