Novosphingobium humi: PQ457_11880 Help Entry PQ457_11880       CDS       T08806                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nhum  Novosphingobium humi Pathway nhum01100   Metabolic pathways nhum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nhum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PQ457_11880    00074 Mycolic acid biosynthesis     PQ457_11880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PQ457_11880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WCT76632 LinkDB All DBs Position complement(2524893..2525129) Genome browser AA seq 78 aa AA seqDB search MSTIEAQVKKIVVEHLGVEEDKVVADASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVNDAIAFIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaggcgcaggttaagaagatcgttgtcgaacacctcggcgttgaagaa gacaaggtcgttgccgatgccagcttcatcgacgatctgggcgctgactcgctcgacatc gttgaactggtgatggctttcgaagaagaattcggcgtggaaattcccgacgatgccgcc gaaaagattgccacggtcaatgacgccatcgccttcatcgaggcgaacaagggctga

DBGET integrated database retrieval system