Novosphingobium humi: PQ457_19810
Help
Entry
PQ457_19810 CDS
T08806
Name
(GenBank) thiamine pyrophosphate-requiring protein
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
nhum
Novosphingobium humi
Pathway
nhum00290
Valine, leucine and isoleucine biosynthesis
nhum00650
Butanoate metabolism
nhum00660
C5-Branched dibasic acid metabolism
nhum00770
Pantothenate and CoA biosynthesis
nhum01100
Metabolic pathways
nhum01110
Biosynthesis of secondary metabolites
nhum01210
2-Oxocarboxylic acid metabolism
nhum01230
Biosynthesis of amino acids
Module
nhum_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nhum_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
nhum00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
PQ457_19810
00660 C5-Branched dibasic acid metabolism
PQ457_19810
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
PQ457_19810
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
PQ457_19810
Enzymes [BR:
nhum01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
PQ457_19810
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_N
TPP_enzyme_M
XFP_N
Aminotran_3
Motif
Other DBs
NCBI-ProteinID:
WCT79250
UniProt:
A0ABY7U155
LinkDB
All DBs
Position
unnamed1:complement(870991..872694)
Genome browser
AA seq
567 aa
AA seq
DB search
MYTTATAFLEALVEQGITHAFVNLGSDHPGLVEAIAEARANGRTVPTIVTCPNEMVALTI
AHGHTQISGKPQAVIIHVECGTQALAGAVHNAAKARIPVLIFAGSSPFTQEGEMLGSRNE
FIQWIQDVHDQRGLVRGYMRYDNEIRTGANVKQLVHRAMQFAKSDPKGPVYLMAPREVLE
APCEPVNIDMERWQPVTPPALGAQDARFLAERLAKAKRPLIVTSYLGRNPAAVDALVALC
AQVGAGVVESVPSYVNLPHDSPFYLGNYWNNPEQNPDLAAADLVLVVDSDVPWIPIKNTP
SDTAEIYHIDIDPLKEQMPLWYIEPHRSYRADAAQALQVIGEAVAALACDADALAEKTAH
YTARSAARRAQVAALETPDGGLTTARLMAALRDQFDEQTIVMNEGITNYQPVFDHLAPTR
AGSMFASGGGSLGWNGGAAIGAKLANPDATVVAVSGDGCYMFTVPSSVHWIARRYETPFL
QVVLNNDGWNAPRHSALAVHPDGHASKANDLDLSFTPAPDYGAIAAASGGAASFVVDRDS
DLAAVLGEAFAVLKNERRTVVVEARLG
NT seq
1704 nt
NT seq
+upstream
nt +downstream
nt
atgtacactactgccactgcctttctcgaagcccttgtcgagcaaggcatcacgcacgcc
ttcgtcaatttgggcagcgaccaccccggacttgtcgaggcgattgctgaagcgcgtgcc
aacgggcgcacggtgcccaccatcgtcacctgccccaacgagatggttgccttgaccatt
gctcatggccacacccagatcagcggcaagccgcaggcggtgatcattcacgtcgaatgc
ggcacgcaggccttggcaggggcggtgcataatgcggcgaaggcgcgcatcccggtcctg
attttcgcgggttcctcgcccttcactcaggagggtgagatgttgggcagccgcaacgag
ttcatccagtggattcaggatgtgcacgaccagcgcgggctggtgcgcggctatatgcgc
tatgacaacgagattcgcaccggcgccaacgtcaagcaactggttcaccgcgcgatgcag
ttcgccaagtcggaccccaaggggccggtctatctgatggccccgcgcgaagtgctggag
gcgccatgcgagccggtgaatatcgacatggagcgttggcagccggtgacgccgcccgca
ttgggcgcgcaggacgctcgctttctggccgaaagattggcaaaagcgaagcgcccgttg
atcgttacctcctatctcgggcgcaatccggcggcggtggacgccttggtagcgctttgc
gcacaagtcggtgccggcgttgtggaatcggtgcccagctacgtcaacctgccgcatgac
agcccgttctaccttggcaattactggaacaatccggagcaaaatcccgaccttgccgcc
gctgatctggtgctggtggtggacagcgacgtgccatggatcccgatcaagaatacgccg
tccgacacggccgaaatctatcacatcgacatcgaccccctgaaggagcagatgccgctg
tggtatatcgagccgcatcgcagctatcgcgctgatgccgcacaagccttgcaggtgatt
ggcgaggcggtggcggcgctggcttgcgatgccgatgcgctggcggaaaaaaccgcgcat
tacaccgcgcgcagcgctgcacgccgggcgcaggtggcggctttggaaacgccggatggc
gggctgaccaccgcccgtttgatggcggctctgcgcgaccaattcgatgaacagaccatc
gtgatgaacgagggtatcaccaattatcagccggtgttcgaccatctggcgcccacccgt
gcgggcagcatgtttgccagcggcggcggatcgctgggctggaacggcggcgcggcgatt
ggtgcgaagctggccaacccggatgccacggtggtcgccgtgtcgggcgatggctgctat
atgttcactgtgccttcgagtgttcactggattgcgcgccgttacgaaacgccctttttg
caagtcgtgttgaacaacgacggttggaacgcgccgcgccattcggcccttgccgttcat
cccgatggccatgccagcaaggccaatgatctcgacctcagctttacccccgcgcctgat
tatggtgcgattgccgcggcctctggcggcgcggccagctttgtggtcgaccgcgacagc
gaccttgccgccgtgctgggcgaagcctttgccgtgttgaagaacgagcgccgcaccgtg
gtggtcgaggcaaggctgggctga
DBGET
integrated database retrieval system