KEGG   Novosphingobium humi: PQ457_21455
Entry
PQ457_21455       CDS       T08806                                 
Name
(GenBank) diguanylate cyclase
  KO
K11444  two-component system, chemotaxis family, response regulator WspR [EC:2.7.7.65]
Organism
nhum  Novosphingobium humi
Pathway
nhum02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nhum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PQ457_21455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nhum02022]
    PQ457_21455
Enzymes [BR:nhum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PQ457_21455
Two-component system [BR:nhum02022]
 CheA family
  WspE-WspRF (chemosensory)
   PQ457_21455
SSDB
Motif
Pfam: GGDEF Response_reg GGDEF_2
Other DBs
NCBI-ProteinID: WCT79556
UniProt: A0ABY7U438
LinkDB
Position
unnamed1:complement(1273678..1274712)
AA seq 344 aa
MIPQVSVDPDIDDTEQPIPSQPIMVLLVDDQIMVGEAVRRALLDEVGIEFHYCSNPLDAL
AIARTVQPTVILQDLVMPSVNGLDLVRQYRADPHTRNTPIIVLSTKEEASVKSDAFRAGA
NDYLVKLPDRIELIARIRYHSAAYLSQIQRDEAYRALRKSQQELMQANFALQRLTNVDGL
TGLSNRRYFDEYFETEWRQAARDRQPLSLLIIDIDHFKQFNDTYGHLAGDEVLRKVAQAV
QAAFRRPKDLVVRLGGEEFVVVLPATPLGHLAMLAQRAVEAVEALDLAHSSSPVSGRVTI
SVGGAGCQPDRDDRRLALMEAADKALYEAKRSGRNRAVIDRGQS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgattccccaggtctcggtcgatcccgatatcgacgataccgaacagccgatccccagc
cagcccatcatggttctgctggtcgatgaccagatcatggtgggcgaggcggtgcgccgc
gcgctgctggacgaggtggggatcgagttccactattgctcgaacccgcttgatgctttg
gcgattgcccgcacggtgcagcccacggtgatcctgcaggatctggtgatgccctcggtc
aacgggctggatctggtgcgccagtatcgcgccgatccgcatacgcgcaacaccccgatc
atcgttttgtccaccaaggaagaagccagcgtcaagagcgacgcctttcgcgcgggggcc
aatgactatctggtcaaattgcccgaccggatcgagttgatcgcgcgcatccgctatcat
tcggcggcctatctctcacagatccagcgcgatgaggcctatcgcgcgctgcgcaagagc
cagcaggagctgatgcaggccaatttcgcgctgcaaaggttaaccaatgtcgatgggctg
acggggctgagcaaccggcgctatttcgacgaatatttcgagaccgaatggcgccaggcc
gcgcgtgatcgccagcctttgtccttgctgatcattgatatcgaccatttcaagcaattc
aacgacacctatggccatctggccggggatgaggtgctgcgcaaggtggcgcaggcggtg
caggccgcgtttcggcggcccaaggatctggtggtgcggttgggcggtgaggaatttgtc
gtcgtgctgcccgccacgccgctgggccatctggccatgctggcccagcgcgcggtcgag
gcggtcgaggcgctcgatctggcccattcctcctcgccggtatcgggccgggtgacgatc
agcgtgggcggcgcgggatgccaacccgaccgtgatgaccggcggctggcgctgatggag
gcggccgacaaggcgctctacgaggccaagcgctcaggccgcaatcgggcggtgattgat
cgcggccagagctga

DBGET integrated database retrieval system