Natronosporangium hydrolyticum: JQS43_04765 Help Entry JQS43_04765       CDS       T07914                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism nhy  Natronosporangium hydrolyticum Brite KEGG Orthology (KO) [BR:nhy00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     JQS43_04765 Enzymes [BR:nhy01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      JQS43_04765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  QSB15662 UniProt:  A0A895YHX5 LinkDB All DBs Position complement(1025698..1025937) Genome browser AA seq 79 aa AA seqDB search MLTMYSTPWCGYCRRLAAQLDREGIGYTVVDIEQDPAAADYVMKVNGGNQTVPTVTFPDG TALTNPTITQVREQLAAAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgctgaccatgtactccactccctggtgcggctactgccgccggctcgccgcccagctg gaccgggagggcatcggctacaccgtcgtcgacatcgagcaggacccggccgcggccgac tacgtgatgaaggtcaacggcggtaaccagacggtgccgacggtgacattcccggacgga accgccctgaccaacccgaccatcacccaggtacgcgagcagctggccgccgccggctga

DBGET integrated database retrieval system