Natronosporangium hydrolyticum: JQS43_05830 Help Entry JQS43_05830       CDS       T07914                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism nhy  Natronosporangium hydrolyticum Pathway nhy00190   Oxidative phosphorylation nhy01100   Metabolic pathways Module nhy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:nhy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JQS43_05830  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:nhy00194]     JQS43_05830 Photosynthesis proteins [BR:nhy00194]  Photosystem and electron transport system   F-type ATPase [OT]    JQS43_05830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QSB17127 UniProt:  A0A895YH23 LinkDB All DBs Position 1270118..1270324 Genome browser AA seq 68 aa AA seqDB search MNPGLAVIGYGLGAIGAGIGVGLIFASVIIGTARQPEAQGKLVGIAFTTFALVEVLALIG FVLFFLAS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atcaacccgggcctcgcggtcatcggttacggtctcggtgcgatcggcgccggcatcggc gttggcctcatcttcgcgtcggtcatcatcggcaccgcccggcagccggaggcgcagggc aagctggtgggtatcgccttcaccaccttcgccctggtcgaggtgcttgcgctgatcggc ttcgtgctgttcttcctcgcctcctga

DBGET integrated database retrieval system