Nibribacter ruber: GU926_14375 Help Entry GU926_14375       CDS       T06388                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nib  Nibribacter ruber Pathway nib01100   Metabolic pathways nib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GU926_14375    00074 Mycolic acid biosynthesis     GU926_14375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GU926_14375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 AlkZ-rel Motif Other DBs NCBI-ProteinID:  QHL88554 UniProt:  A0A6P1P2C7 LinkDB All DBs Position 3419286..3419543 Genome browser AA seq 85 aa AA seqDB search MITATTPSIAKEVVKIISKTKKVQPSRLRETSNLSKEFGFDTVDVVDIILQLEKSFKIVI PDEVPLNTVGDFVEFVSTHTMRQAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgataactgctacaacaccttccattgccaaagaggtagtcaaaatcatcagcaaaacc aaaaaggtgcagccgtcacgcttgcgtgagacgtctaacctgagcaaggagtttggcttt gacacggtagacgtggtagatattatccttcaacttgagaagagcttcaagattgtgatt ccggacgaagtgccgttgaacaccgtgggagactttgtagaattcgtgtctacgcatacc atgcgccaggccagctag

DBGET integrated database retrieval system