Nitrosomonas sp. Is79A3: Nit79A3_1421 Help Entry Nit79A3_1421      CDS       T01569                                  Name (GenBank) deoxyUTP pyrophosphatase   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism nii  Nitrosomonas sp. Is79A3 Pathway nii00240   Pyrimidine metabolism nii01100   Metabolic pathways nii01232   Nucleotide metabolism Module nii_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:nii00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     Nit79A3_1421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:nii03400]     Nit79A3_1421 Enzymes [BR:nii01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      Nit79A3_1421 DNA repair and recombination proteins [BR:nii03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     Nit79A3_1421  Prokaryotic type     Nit79A3_1421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dUTPase PUMA Motif Other DBs NCBI-ProteinID:  AEJ01253 UniProt:  F8GG71 LinkDB All DBs Position 1530854..1531219 Genome browser AA seq 121 aa AA seqDB search MKFELRILNGMVTEDHLKPKTSGSAGIDLMAVSFPSISANNDGFVDINPGEVILIGTGIA IHIESPGYAGMILPRSGLGHKGLVLGNLVPLIVSCTLCQHPFSVAAHWMMMPLIGRVFMP P NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaaatttgaattgcgtatattgaatggcatggttactgaggatcatctgaaaccaaag acatctgggagcgccggtatcgatctgatggcggtgtcatttccttcgatttcagctaac aatgacggttttgttgatatcaatcctggtgaggtgatattaattggtactggaatcgct attcatatcgaaagcccaggatacgccgggatgatattgccgcgctcaggattggggcat aaagggcttgtgcttggtaacctggtgccattgatcgtttcctgcacgttatgccagcac ccatttagcgtggccgcgcactggatgatgatgccgttgattggtcgagtattcatgccg ccatga

DBGET integrated database retrieval system