Candidatus Nitrospira inopinata: NITINOP_0257 Help Entry NITINOP_0257      CDS       T04169                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism nio  Candidatus Nitrospira inopinata Pathway nio00998   Biosynthesis of various antibiotics nio01100   Metabolic pathways nio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NITINOP_0257 (acpP)    00074 Mycolic acid biosynthesis     NITINOP_0257 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NITINOP_0257 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  CUQ65233 UniProt:  A0A0S4KLB6 LinkDB All DBs Position 1:complement(237794..238027) Genome browser AA seq 77 aa AA seqDB search MATVEERVKKIIAEQLGVEEDEVTPEASFVEDLGADSLDTVELVMALEEEFSIEIPDEDA EKILTVGKALEYIKEKC NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaaccgttgaggagcgtgtcaagaagatcattgccgagcaattgggcgtggaggag gacgaggtgacgccggaggcgtccttcgtcgaagacctcggcgccgattcgcttgatacc gtggagttggtgatggcgctggaggaagagttctcgatcgaaattccggacgaggacgcc gaaaaaattctgacggtcggaaaggcgttggagtacatcaaggaaaaatgttag

DBGET integrated database retrieval system