Nitrosopumilus sp. K4: NsoK4_02150 Help Entry NsoK4_02150       CDS       T07707                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nip  Nitrosopumilus sp. K4 Pathway nip03010   Ribosome Brite KEGG Orthology (KO) [BR:nip00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NsoK4_02150   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NsoK4_02150  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nip03011]     NsoK4_02150    04121 Ubiquitin system [BR:nip04121]     NsoK4_02150 Ribosome [BR:nip03011]  Ribosomal proteins   Eukaryotes    Large subunit     NsoK4_02150   Archaea     NsoK4_02150 Ubiquitin system [BR:nip04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NsoK4_02150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e Motif Other DBs NCBI-ProteinID:  QUC65090 UniProt:  A0A8B2HPF8 LinkDB All DBs Position 371771..371938 Genome browser AA seq 55 aa AA seqDB search MPITDPEKKRIAQHARLVMRICFNCGCRNDIDATRCRKCRNPYLRLKNRNLGAKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atgccaatcacagacccagaaaaaaaacgaattgctcaacatgctaggcttgttatgaga atttgctttaattgtgggtgcagaaatgacattgatgcaacaagatgcagaaaatgtaga aatccctacttgagattaaagaacagaaatctgggcgctaagaaatag

DBGET integrated database retrieval system