Nitrosopumilus sp. K4: NsoK4_05680 Help Entry NsoK4_05680       CDS       T07707                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nip  Nitrosopumilus sp. K4 Pathway nip03010   Ribosome Brite KEGG Orthology (KO) [BR:nip00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NsoK4_05680   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NsoK4_05680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nip03011]     NsoK4_05680    04121 Ubiquitin system [BR:nip04121]     NsoK4_05680   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nip04147]     NsoK4_05680 Ribosome [BR:nip03011]  Ribosomal proteins   Eukaryotes    Small subunit     NsoK4_05680   Archaea     NsoK4_05680 Ubiquitin system [BR:nip04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NsoK4_05680 Exosome [BR:nip04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NsoK4_05680   Exosomal proteins of colorectal cancer cells    NsoK4_05680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_Nudix DUF1451 Cas12f1-like_TNB Ephrin_rec_like DZR_2 Zn_ribbon_11 zf_UBZ Motif Other DBs NCBI-ProteinID:  QUC63953 UniProt:  A0A8B2HT05 LinkDB All DBs Position 946259..946432 Genome browser AA seq 57 aa AA seqDB search MAGKKGSSPNVYKYFKVDGDKVSRIRKICSRCGKGVYMSEHKDRHTCGKCGLTEFNQ NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggcaggaaaaaagggttctagtccaaatgtatacaaatacttcaaagtagatggagac aaagtttcaagaattagaaaaatttgttcaagatgtggcaaaggcgtctatatgtctgaa cataaagacagacacacatgtggtaagtgtggactaacagagtttaatcaataa

DBGET integrated database retrieval system